SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00021200001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00021200001
Domain Number 1 Region: 105-268
Classification Level Classification E-value
Superfamily RNI-like 0.00000000471
Family 28-residue LRR 0.063
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily F-box domain 0.000000011
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00021200001
Sequence length 294
Comment (Vitis vinifera)
Sequence
MKRIPGAADRISKLPSNIIDDILVRLPIHDAVRTSILSRKWRYKWLTLPQLVFEDSFSEQ
MTKELGVLSEEKLLAAVYQALLLHKGPIVKFSLAVPEFESCSSVDHWIHFLSYHDIQEFS
LSFSTGSAHVLPYHIFYFLHLRHLKLRLCQFKPPPAFGGFSRLISLEFISMDFEAGQFGT
FISNSPLLEQLRVFDGSTFNHLEISAPNLKIFLFRGVFESILFKNTPVLAVVSIALNRAV
NQRRGQCSKPMKLADSLPALEKLYVGYNFLKVNNSLVVPFSASYILIFSIWFSC
Download sequence
Identical sequences 29760.GSVIVG00021200001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]