SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00021360001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00021360001
Domain Number 1 Region: 323-625
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-81
Family Protein kinases, catalytic subunit 0.0000722
Further Details:      
 
Domain Number 2 Region: 25-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.53e-75
Family Legume lectins 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00021360001
Sequence length 692
Comment (Vitis vinifera)
Sequence
MATSLTILLAIVFLLSTPVTSQVDEIFYGGFSDVGANLTKTGVAEIDKDGILRLTNETSR
LMGHAFHSFPLQFKNSTNGTAFSFSTSFAFAIVPEYPKLGGHGFAFAISPSKELRGALPS
QYLGLLNASDIGNFSNHLFAVEFDTVKDFEFEDINDNHVGIDIDSLESNASSPAAYYTDD
STQQSINLQSGNTIQAWIDYDSVGNVLNVTLSPSSSKPKLPILSFPLDLSPILQEFMYVG
FSASTGLLASSHYVFGWSFKMNGVARSLDLSSLPSLPEPKERHTALTIGLSVSSVVLVIS
AVSIIIYMIRKIRNADVIEAWELDIGPHRFSYQELKKATKGFRDKELLGHGGFGRVYRGT
LPNSQTQIAVKRISHDSKQGMREFVSEIASIGRLRHRNLVQLLGWCRRYGNLMLVYDFME
NGSLDKFLFDEPKLILSWEQRFNIIKGVASGLLYLHEGYEQVVIHRDIKASNVLLDNELN
GRVGDFGLARLYEHGSNPGTTRVVGTLGYLAPELSRTGKATTNSDVFAFGALLLEVTCGR
RPIEAKALPEELVLVDWVWDKWTEGRILEAVDSTLTGQYDEGEVVMVLKLGLLCSSYSPT
ARPSMRQVVRYLEGEVEVPAVLNPPCAYDGGKDDSPGFNDFVHSYVSSSYEKGSSCSVDN
ENVNAGFASVNASPLSLLNGRGTTGGSLGSSF
Download sequence
Identical sequences F6HL80
29760.GSVIVG00021360001 XP_010654249.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]