SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00022083001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29760.GSVIVG00022083001
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily RNI-like 0.000451
Family Cyclin A/CDK2-associated p19, Skp2 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00022083001
Sequence length 64
Comment (Vitis vinifera)
Sequence
MATTMLAINPICSNLISFNLSYALEIHGTELIKLICHYKKLQQLWILDCARDKGLGGYVY
LCGL
Download sequence
Identical sequences 29760.GSVIVG00022083001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]