SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00022657001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00022657001
Domain Number 1 Region: 400-767
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.6e-118
Family Motor proteins 0.0000007
Further Details:      
 
Domain Number 2 Region: 46-146
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-17
Family Calponin-homology domain, CH-domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00022657001
Sequence length 1033
Comment (Vitis vinifera)
Sequence
MATAEDGVLDFSVASVVEDVLQQQGNRLSDVDLASRKAEEASLRRYEAAGWLRRMVGVVG
GRDLAAEPSEEEFRLGLRSGIILCNALNKVQPGAVSKVVEGTYDSVVTPDGAALSAFQYF
ENVRNFLVALEEMGLPSFEASDLEQKMMGFWSCKFASIFGVRSTFTKIKFGNEPALRYWP
PFSNSNEQFLNSDLGNDPSEMVSLLPYYKERVVRTSTFNTSRPFNTLVRAALSDKKQEEI
PNIVESLLSKVMEEFEIRLTSQNELVSVAPCECLCMIIVKSQARMASPSADAMIKMEEKA
STQIIKEECYNQDDTHDEESERPFLKQQLLFEQQRRDLQELKHTLHSTKAGMQFMQMKYH
EEFENLGNHLHGLVHAASGYRRVLEENRKLYNQLQDLKGSIRVYCRVRPFLDGQPKCLSS
VDQIEEGSISIITPSKYGKEGRKSFNFNKVFGPSATQEEVFSDTQPLIRSVLDGYNVCIF
AYGQTGSGKTYTMTGPKELTEEGLGVNYRALSDLFHLSEQRKGTLHYEVSVQMIEIYNEQ
VRDLLVTDGLNKKYPFLLHGIEIRNSSQNGINVPDANLVPVSSTSDVIYLMNLGQKNRVV
SATALNDRSSRSHSCVTVHVQGRDLTSGAVIRGSLHLVDLAGSERVDKSEVTGAGLKEAQ
HINRSLSALGDVIASLAQKNSHVPYRNSKLTQLLQDSLGGQAKTLMFVHISPEPEALGET
ISTLKFAERVSTVELGAARVNKESSDVKELREQIANLKAALARKEGESEHQMYSRSSSPE
RLKMKSRGSSPSLPSLRSVADISGSRRQPMEDVGNIQVRNNSALKPRRQSFDLHDLAKAS
AAWKTGSSPAMSSQKEDEGEIGSGDWVDKAMLNKQYNVSRDRNSPGSWEEDNRQLPEMFF
QTHLPNPAKIYPEQPFNKFSTNQKDGRDYDGQRNRFEVATDDSDELEAATSDCSEQDLLW
QQLNLPRVSNIPNGLGSKNKRTNSKLVKSPEKRSLIPSLGTSASRKLPIGISPPLHRRQA
VAVDGKQRTGNAK
Download sequence
Identical sequences 29760.GSVIVG00022657001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]