SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00023648001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00023648001
Domain Number 1 Region: 180-314
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-31
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 85-177
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.15e-24
Family Cold shock DNA-binding domain-like 0.00014
Further Details:      
 
Domain Number 3 Region: 44-82
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000131
Family ECR1 N-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00023648001
Sequence length 320
Comment (Vitis vinifera)
Sequence
MRGFQLSLNQTQKLRLQRALEQLESLSSKSNSNASVAVADTIPVNYEDGVLKGHGTLDLD
GEVVATLCGVVERVNKLVYIRTLRARYKPETGDIIVGRVTEIAPKRWRLDINFSQDAVLM
LSSMNLPDGIQRRRTAVDELNMRSIFEENDIVCAEVRGFQHDGSLHLQARSQKYGKLERG
QVLTISPYLVKRRKQHLHYLEEFGVDLILGCNGFIWVGEHVEAKGILIEDQTDKAEQLNT
KSSKRTYTSLETRQNICRIANAVRVLANLGFSVTVEVIKETVNLSSSLNLDIHEMLGSEF
YVLVAEGEATRKSMFTKKKG
Download sequence
Identical sequences GSVIVT01011064001 29760.GSVIVG00023648001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]