SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00023917001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00023917001
Domain Number 1 Region: 138-256
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.4e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00023917001
Sequence length 281
Comment (Vitis vinifera)
Sequence
MSGLYTQNFSSARALSPHIRTAPDVESQYLTELLAEYQKLVPFMQVLPVCSRLLNQEILR
VSSMIPKQGFGDFDRLQRGSPSPLGSSEMMPNIRGTSLGGWNGLPHERLGGPQGMTMDWQ
APPGSPSSYIVKKILRLEIPVDSYPNFNFVGRLLGPRGNSLKRVEASTGCRVYIRGKGSI
KDPDKEEELRGRPGYEHLNDPLYILIEAELPVSIVDVQLRRAQEIIEELLKPVDESHDFY
KRQQLRELALLNSNFREESPQPRGSASPFSSSGMKRAKTGR
Download sequence
Identical sequences D7SJG9
GSVIVT01024534001 29760.GSVIVG00023917001 XP_002264308.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]