SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00024224001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00024224001
Domain Number 1 Region: 6-97
Classification Level Classification E-value
Superfamily POZ domain 1.88e-29
Family BTB/POZ domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00024224001
Sequence length 98
Comment (Vitis vinifera)
Sequence
MRKEDTVKLISAEGFEFVIDKRAAMVSQTIRNMLTSPGSFAEREHGEVTFPEISTTILEK
ICQYFYWSLQFASGKDTEFPIEPELTLELMMAANYLHT
Download sequence
Identical sequences F6GUX4
29760.GSVIVG00024224001 XP_002282124.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]