SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00024583001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00024583001
Domain Number 1 Region: 151-269,305-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-34
Family SPRY domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00024583001
Sequence length 389
Comment (Vitis vinifera)
Sequence
MDDLRATYRDEDEEDDDCATTATATANGVKHEPPEDHDHSDESKPSSDDDEEDPPPKKQK
QLSSLNAPTLPEENQATEQAISIAAAAVGATETPKIAKKAKKKSNNVWTKSTSRKGKKKA
KATANNAPTEDPVLITPVPRFPDKNDDAPDMKICLSKIYKAEKVELSDDRMRAASGKGYR
MVRATRGVVEGAWYFEIRVLKLGETGHTRLGWSTEKGDLQAPVGYDANSFGYRDIDGTKV
HKALRETYGGEGYVEGDVIGFYINLPDGAMYAPKPPHLVWYKGQRYVCATDTKEDPPKVV
PGSEISFFKNGVCQGVAFKDLCGGRYYPAASMYTLPNQPHCVVKFNFGPDFEFFPEELNG
RPVPRPMIEVPYHGFDSQTENGVSNEKKH
Download sequence
Identical sequences D7SL21
GSVIVT01025234001 29760.GSVIVG00024583001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]