SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00024711001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00024711001
Domain Number 1 Region: 101-177
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 199-230
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000536
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 38-63
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000497
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00024711001
Sequence length 234
Comment (Vitis vinifera)
Sequence
MELGGARKRGRQEGTLNGNGGFKKSKQEMESFSSGIGSKSKPCTKFFSTSGCPFGEGCHF
LHYVPGGIKAVSQMKSCNHRGMGSGRLAGRLEPPPPGLAAAASFGASATAKISVDASLAG
AIIGKSGVNSKQICRLTGAKLSIKDHDSDPNLRNIELEGTFDQIKQASAMVRELIVNISS
ASGPPMRNPAMQASAAANNFKTKLCENFTKGSCTFGERCHFAHGADELRKPAGM
Download sequence
Identical sequences 29760.GSVIVG00024711001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]