SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00024818001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00024818001
Domain Number 1 Region: 1697-2013
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.06e-103
Family Calpain large subunit, catalytic domain (domain II) 0.00000343
Further Details:      
 
Domain Number 2 Region: 2011-2157
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.49e-29
Family Calpain large subunit, middle domain (domain III) 0.00089
Further Details:      
 
Domain Number 3 Region: 1431-1614
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000158
Family Laminin G-like module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00024818001
Sequence length 2159
Comment (Vitis vinifera)
Sequence
MEGHERELLLACVVSGTLFSVLSVASLCILWAVNWRPWRIYSWIFARKWPDILQGPQLGL
LCGMLSLSAWIFVISPIVMLIIWGCWLIMILGRDIIGLAVIMAGIALLLAFYSIMLWWRT
QWQSSRAVAALLLVAVALLCAYELCAVYVTAGASAAERYSPSGFFFGVSAIALAINMLFI
CRMVFNGNGLDVDEYVRRAYKFAYSDCIEMGPLACLPEPPDPNELYPRQSRIHICRASHL
GLLYLGSLLVLLVYSILYGQTAMEAQWLGAITSAAVIILDWNMGACLYGFQLLKSRVVAL
FVAGLSRVFLICFGVHYWYLGHCISYAVVASVLLGAVVSRHLSATNPLAARRDALQSTVI
RLREGFRRKEQNSSASSSEGCGSSVKRSSSAEAGHLGNVIETSSRSAAQCIGDASNWNNV
ISHEGINSDKSIDSGRPSLALRSSSCRSVAQEPEAGGSTDKNFDHNSCLVVCSSSGLESQ
GYESSASTSANQQLLDLNLALVFQEKLNDPMVTSMLKKRARQGDRELTSLLQDKGLDPNF
AMMLKEKSLDPTILALLQRSSLDADRDHRDNTDITIIDSNSVDNGLLNQISLSEELRLKG
LEKWLQWSRFVLHHIAGTPERAWVLFSFIFILETVIMAIFRPKTVKLVNSKHEQFEFGFA
VLLLSPVICSIMAFLRSLQAEEMAMTTKPRKYGFIAWLLSTCVGLLLSFLSKSSVLLGLS
LTFPLMVACLSVSIPIWIHNGYQFWVPRVESAGHPGHHRTPGKKEGVVLVICILVFAGSI
FALGAIVSVKPLEDLRYKGWTGDQRTFTSPYASSVYLGWAIGSVIALVVTGVLPIISWFA
TYRFSLSSAVCAGIFSVVLVAFCGASYLEVVKSRDDQVPTKGDFLAALLPLVCFPALLSL
CTGLYKWKDDDWKLSRGVYVFVIIGLLLLLGAISAVVVIVEPWTIGVACLLVLLLIALAI
GVIHYWASNNFYLTRTQMFFVCFIAFLLALAAFLVGWYEDKPFVGASVGYFSFLFLLAGR
ALTVLLSPPIVVYSPRVLPVYVYDAHADCGKNVSVAFLVLYGIALATEGWGVVASLKIYP
PFAGAAVSAITLVVSFGFAVSRPCLTLKMMEDAVHFLSKETVVQAIARSATKTRNALSGT
YSAPQRSASSAALLVGDPTVMRDRAGNFVLPRADVMKLRDRLRNEEVAAGSFFCRVRNGR
TFWHESTSDIGYRREMCAHARILALEEAIDTEWVYMWDKFGGYLLLLLGLTAKAERVQDE
VRLRLFLDSIGFSDLSAKKIKKWMPEDRRQFEIIQESYIREKEMEEEILMQRREEEGRGK
ERRKALLEKEERKWKEIEASLISSIPNAGSREAAAVAAAVRAVGGDSVLDDSFARERVSS
IARRIRMAQLARRALQTGVTGAVCVLDDEPTTSGRNCGQIDPTICQSQKVSFSIAVTIQP
ESGPVCLLGTEFQKKVCWEILVAGSEQGIEAGQVGLRLITKGDRQTTVAKEWSISATSIA
DGRWHIVTMTIDADLGEATCYLDGGFDGYQTGLPLRVGNGIWEQGTEVWIGVRPPIDIDA
FGRSDSEGAESKMHIMDVFMWGRCLTEDEIAAFYGAMGSAEYSMIDFPEDNWQWADSPSR
VDEWDSDPAEVDLYDRDDVDWDGQYSSGRKRRSEREGMVVDVDSFARRLRKPRMETREEI
NQQMLSVELAVKEALSARGETHFTDQEFPPNDQSLFVDPENPPLRLKVVSEWMRPTDMVK
ESYLDAGPCLFSGAANPSDVCQQGRLGDCWFLSAVAVLTEVSRISEVIITPEYNEEGIYT
VRFCIQGEWVPVVVDDWIPCESPGKPAFATSRKGNELWVSLLEKAYAKLHGSYEALEGGL
VQDALVDLTGGAGEEIDMRSAQAQIDLASGRLWSQLLRFKQEGFLLGAGSPSGSDVHVSS
SGIVQGHAYSLLQVREVDGHKLVQVRNPWANEVEWNGPWADSSPEWTERMKHKLKHVPQS
KDGIFWMSWQDFQIHFRSIYVCRIYPPEMRYSLRGQWRGYSAGGCQDYDTWHQNPQFHLR
ATGPDASFPIHVFITLTQGVSFSRTTAGFRNYQSSHDSMMFYIGMRILKTRGRRAAYNIY
LHESVGGTDYVNSREISCEMVLEPDPKGYTIVPTTIHPGEEAPFVLSVFTKASVTLEAL
Download sequence
Identical sequences 29760.GSVIVG00024818001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]