SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00025391001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00025391001
Domain Number 1 Region: 311-636
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-78
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 31-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.66e-46
Family Legume lectins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00025391001
Sequence length 655
Comment (Vitis vinifera)
Sequence
MLHNRSLLCFSSVVNFLLLVALLVGAVAQAGCFSFNYSSFTEEDETNLILKNSYIALGGI
QVTPDVSSIDFSRNQSGRALYKRPFRLWSKSKGMASFNSTFVLNIINTTNPGGDGLAFIL
TGHTDLPSNSQGQWLGIVNEATVSSPEIETVAVAFLTGRSNTENLNGSRIGLNLNGYLKK
QESLYVDLSSGMDVKVRIRYDGEVLRVFVGEDTSSPAISDSLNFSIYLRHKVYVGFSAST
GNYSQLNYVRSWEFSVLDLDDHQMPQWIWIIVAAVIALFIGFAFSLYWKWKYYVRKGDDP
GFELQIQGLSTAPRKFRLKELESATENFNSDNLLGRGGFGTVYKGVSINREVAVKRFSRN
SHEGKQDFIAEITTISNLHHRNLVKLLGWCHERDELLLVYEFMPNKSLDKLIFCNQNHGA
ETNPVTLNWERRHGVIYGVTQALDYLHNGCEKRVLHRDIKASNVMLDSEFNARLGDFGLA
RTINPSDQTHHSTKAIAGTPGYMAPESFLIGRATVQTDVYAFGVLVLEVVCGRKPGRQST
QNNYNNSIVDWVWENYRGGSILDVVDLQLNGIFSKEQAECVLVLALACCHPNPYQRPSMR
TVLRVLAGEVAPPVIPMDRPAFVWPPAMPPSLNEDLQDYTFSGDRNTPSSELIGR
Download sequence
Identical sequences XP_002275519.1.54126 29760.GSVIVG00025391001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]