SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00026115001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00026115001
Domain Number 1 Region: 31-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.43e-77
Family Glycosyl hydrolases family 16 0.0000000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00026115001
Sequence length 296
Comment (Vitis vinifera)
Sequence
MAVPSVLPLLFGFLAFSVVVFVGSASSSKFTELFQPGWAFDHFLYEGELLKLKLDNYSGA
GFSSKSKYMFGKVSIQIKLVEGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQT
NIYVNGVGNREQRLNLWFDPTKDFHSYTFMWNQRQVVFLVDETPVRVHTNMEKHGLPFPK
DQPMGVYSSIWNADDWATQGGRVKTDWSHAPFIASYKGFEIDACECPIAVAADDNAKRCS
SSGEKRYWWDEPTLAELNLHQSHQLLWVRANHMVYDYCTDSARFPATPVECQHHRH
Download sequence
Identical sequences A5BHG3
XP_002281574.1.54126 29760.GSVIVG00026115001 GSVIVT01000416001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]