SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00028326001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00028326001
Domain Number 1 Region: 545-620
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 380-466
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000547
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 3 Region: 32-90
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 138-221
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 5 Region: 300-359
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000124
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00028326001
Sequence length 623
Comment (Vitis vinifera)
Sequence
MGETGKRFRSQRDQDGDNKIQKRRVNERDEKGSDELIVYRILCPDGVIGSVIGKSGKVIN
SIRQDTRAKIKVVDPFPGAKDRVITIYCYVKEKEEVEVDDEFNDKQPLCPAQDALLKVHA
AIVNAVASLENSDKKKKDKEECQILVPSSQSANVIGKAGATIKRLRSKTRANIKITAKDS
TDPSHSCAMEFDNFVLIAGDSEAVKKALFAISAIMYKFTPREEIPLDTTVPEAPPSIIIP
SDVPIYPAGGFYPSADSIVSARSVPPVLAATHVPELQGYSDMGSTWPVYSSNLPVVSGYG
ASRSEELIIRVLCPFDKIGRVIGRGGSSIKSVREASGAHVEVDDTKADRDECLITVTSTE
SVDDLKSMAVEAVLLLQAKINDEDDDTVAIRLLVPSKIIGCIIGKSGSIINEIRKRTRAD
VRISKSERPKCADANDELIEVVGEVGSVRDALVQIVLRLRDDALKDRDTGHNTSAGTDSL
YSGGAGLSVSSVLPSAPPVAPLSYDQRAETGSGLGLLSSSSLYGYGSLSVGENAYGSMSS
YSSKLYGGLPTPSTFDMVIPANAVGKVMGKGGANIANIRKISGAVIEISDSKSSRGDRVA
LISGTPEQKRTAENLIQAFIMAT
Download sequence
Identical sequences F6HLT4
29760.GSVIVG00028326001 XP_002278367.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]