SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00028951001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00028951001
Domain Number 1 Region: 184-280,332-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.83e-22
Family Galectin (animal S-lectin) 0.011
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00028951001
Domain Number - Region: 504-627
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00197
Family Spore coat polysaccharide biosynthesis protein SpsA 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00028951001
Sequence length 670
Comment (Vitis vinifera)
Sequence
MKRGKFDTLVPTSRLKSFKILAGLLFLYLIFMSFEIPLVLRTGFGSLPGDGFNGFLGDAF
SQQFMLESEQDMAEKDAPSRPSFRVSKGLSQSSRFRAPARRMREYKKVSGLAFHGGLLNS
KDGYSELHKSAKHAWEVGKTLWEKLDSGEIQVESKRKAQNQSESCPHSIALSGSEFQDRN
KIMVLPCGLTLGSHITVVGKPHWAHAEYDPKIALLKDEDQSVMVSQFMMELQGLKTVDGE
DPPRILHFNPRLKGDWSGKPVIEQNTCYRMQWGSALRCEGWKSRADEETVDGQVKCEKWI
RDDDSHSEESKATWWLNRLIGRTKKVAIDWPYPFAEEKLFVLTVSAGLEGYHVNVDGRHV
TSFPYRTGFVLEDATGLFVNGDIDVHSVFAASLPASHPSFAPQLHLEKLPKWQASPLPDG
PVELFIGILSAGNHFAERMAVRKSWMQHNLVKSSKVVARFFIALHGRKEINVELKKEAEY
FGDTVIVPYMDNYDLVVLKTVAICEYGARTAAAKYIMKCDDDTFVRVDAVIKEARKVHED
NSLYVGNMNYYHKPLRYGKWAVTYEEWPEEDYPPYANGPGYIVSYDIAEFIVSEFEKHKL
RLFKMEDVSMGMWVEQFNSSMPVQYLHSVKFCQFGCIEDYYTAHYQSPRQMICMWEKLQQ
QGKAHCCNMR
Download sequence
Identical sequences F6HPH6
29760.GSVIVG00028951001 XP_002268603.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]