SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00029399001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00029399001
Domain Number 1 Region: 95-211
Classification Level Classification E-value
Superfamily POZ domain 4.97e-19
Family BTB/POZ domain 0.0056
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00029399001
Domain Number - Region: 195-262
Classification Level Classification E-value
Superfamily Staphylokinase/streptokinase 0.0915
Family Staphylokinase/streptokinase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00029399001
Sequence length 282
Comment (Vitis vinifera)
Sequence
MDCSICSAVPFILRPPRNTICAACYESARSIVAFINKLENDKGFDKSNNSIVSPANSSKI
KFNASSQLLILMMFIENNWSTEMKEIEEELNEKLSFLGGFAAAFRDQIHTDIEVKPGHNG
PSLFAHRALLAARSEIFKNMLDSDGCKAAPSNTITLPELNHEELDSLLEFLYSGSLPADK
VEKHVYSLSLAADKYEIPFLQKFCEQRMLGSLSSSSALDVLEISDACSSQTVKETALNYI
VKNMEDIVFSTRYESFALKNPHLCVQITRASFMDAKNRKNGV
Download sequence
Identical sequences 29760.GSVIVG00029399001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]