SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00030638001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00030638001
Domain Number 1 Region: 29-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-68
Family Glycosyl hydrolases family 16 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00030638001
Sequence length 332
Comment (Vitis vinifera)
Sequence
MVDSCLLLLLICSVLGLVSGSSKELPIISFDEGYSPLFGDANLAILKDGETVHMSLDERT
GSGFISQDLYLHGFFSASIKLPADYTAGVVVAFYMSNADMFEANHDELDFEFLGNIRGKD
WRIQTNVYGNGSTNVGREERYHLWFDPSEDFHQYSILWSDNLIIFYVDNVPIREIKRTEA
MGGDFPSKPMSLYATIWDGSEWATNGGRYRVNYKYAPYVAEFSNLVLHGCAVDPIEKSPK
CDNGPTSKASIPTGIMPEQRSKMEKFRKTHMTYSYCYDRVRYTVPPSECVVNAQEAERLR
RFDPVTFGGRRHHHHGKRHQRNRSSQGEATTI
Download sequence
Identical sequences D7T8G6
29760.GSVIVG00030638001 XP_002285140.1.54126 GSVIVT01011603001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]