SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00031399001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00031399001
Domain Number 1 Region: 31-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.05e-80
Family Glycosyl hydrolases family 16 0.0000000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00031399001
Sequence length 287
Comment (Vitis vinifera)
Sequence
MAAFCSFRRGLAGLQVSLIISFLAAASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKA
SGSGFQSKNEYLFGKIAMQIKLVPGNSAGTVTAYYLSSKEWETHDEIDFEFLGNLSGDPY
ILHTNVYIQGQGKREKQFYLWFDPTADFHNYSILWNPQCVVFWVDGIPIREFKNLESAGV
LFPKSQPMRIYSSLWNADDWATRGGLVKTNWSQAPFVASYRSFNADACILYSGTSSCSWD
SPPWLSQVLDSTDQQKMKWVEDNYMIYNYCTDAERFSQGLPTECMVT
Download sequence
Identical sequences 29760.GSVIVG00031399001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]