SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00031407001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00031407001
Domain Number 1 Region: 32-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.91e-88
Family Glycosyl hydrolases family 16 0.0000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00031407001
Sequence length 297
Comment (Vitis vinifera)
Sequence
MAPIYSSSSAVSTALLISVVVSFLMAASAGNFYQDFGITWGDGRAKILDNGEFLTLSLDK
TSGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPY
ILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGV
PYLKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNADACIWSSGASSCSSN
TPTSISPSTDWYSQELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECTATTTS
Download sequence
Identical sequences F6GXE1
29760.GSVIVG00031407001 XP_002274601.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]