SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00033645001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00033645001
Domain Number 1 Region: 138-256
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.97e-32
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00033645001
Sequence length 281
Comment (Vitis vinifera)
Sequence
MSGLYNHNFSPARAVSPQIRSTPDVDSQYLSELLAEHQKLGPFMQVLPICSRLLNQEIIR
VSGMISNQGFGDFDRLQHRSPSPMASSNLMSNVSGTGLGGWNGLPQERLSGPHGMTMDWQ
GAPASPSSYTVKRILRLEIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSI
KDPEKEDKLRGRPGYEHLNDPLHILIEADLPANIVDMRLRQAQEIIEELLKPVDESQDFI
KRQQLRELALLNSNFREESPGPSGSVSPFNTSGMKRAKTGR
Download sequence
Identical sequences D7TKY7
XP_002268790.1.54126 GSVIVT01029865001 29760.GSVIVG00033645001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]