SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00033682001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00033682001
Domain Number 1 Region: 126-221
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 7.45e-23
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0026
Further Details:      
 
Domain Number 2 Region: 222-278
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 6.67e-16
Family Head domain of nucleotide exchange factor GrpE 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00033682001
Sequence length 313
Comment (Vitis vinifera)
Sequence
MATLLRAPFTAPPPQSLTSICTQSPKAFHLPLTRRCALNASRLTSSLRFSPILHIRFLRF
DPFASNGEATETQEVQDSEIEDITHHSFEIAMDITGLEQDALVSNDESKAAEIEAFIKFI
EDEKIDLEKKVAALSEELSSDKERILRISADFDNFRKRTDRERLSLVTNAQGEVLENLLP
VLDNFERAKAQIKVETEGEEKINNSYQSIYKQFVEILGSLGVTPVETIGNPFDPLFHEAI
MREDSTEFEEDVIIQEFRKGFKLGDRLLRPSMVKVSAGPGPAKAEAVGSSEEEAVRVTET
ETSGEGTPEGESG
Download sequence
Identical sequences 29760.GSVIVG00033682001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]