SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00035693001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00035693001
Domain Number 1 Region: 75-150
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.92e-26
Family Skp1 dimerisation domain-like 0.0000957
Further Details:      
 
Domain Number 2 Region: 4-62
Classification Level Classification E-value
Superfamily POZ domain 1.29e-17
Family BTB/POZ domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00035693001
Sequence length 152
Comment (Vitis vinifera)
Sequence
MAKTVNLKSSDGHIFTVEEAVALKCHTIKNVVEDTGDDEVLLPKVNGKTLAKVMEYCEKH
VKEPSGLDQKEVDEMKKWDMEFVDVDQAVLYDMLMAANYLSIAGLIELICMKAADMIRGK
SPEQIREIFKIENDFTKEEEAKIRGENAWAFE
Download sequence
Identical sequences F6H9X1
XP_002265139.1.54126 29760.GSVIVG00035693001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]