SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00036126001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00036126001
Domain Number 1 Region: 128-203
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.7e-29
Family Skp1 dimerisation domain-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 57-116
Classification Level Classification E-value
Superfamily POZ domain 9.68e-21
Family BTB/POZ domain 0.00063
Further Details:      
 
Domain Number 3 Region: 2-34
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000101
Family Skp1 dimerisation domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00036126001
Sequence length 205
Comment (Vitis vinifera)
Sequence
MQAANYLGIKSLLDLTCQTVADMIKEMSGNENCEIHLLIKERSLEKICKIYNIKTKLTLQ
SSDGMFFYVDVAVAMESQTIKHMIEDRCADNAIPLPNVTSKILARVIEYCKKHVETPKAE
EHAVNDELRAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKGKTPSEIRK
TFIYKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences 29760.GSVIVG00036126001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]