SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_1221 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_1221
Domain Number 1 Region: 330-461
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.2e-23
Family HD domain 0.037
Further Details:      
 
Domain Number 2 Region: 221-307
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000469
Family Eukaryotic type KH-domain (KH-domain type I) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_1221
Sequence length 533
Comment (Frankia EAN1pec)
Sequence
MVADLRREARDVEEEVERIRRRAEQDAAEQTERVRREAEQIRRHAEEAAEAIRERAVADA
ELRASRAEAAARDAIHAEREQIRAELDEDLRTQRTELRGWDSRLTQREQRVTDQAASVEE
RLRRLETREAELAVREAGLDSRESDLGELEEARRRELERVAGLTSAEARTELVKVVEDQA
RLDAAVRVRDIEARAEEEAEDRARRIVTLAIQRVASDQTAESVVSVLHLPSDEMKGRIIG
REGRNIRAFESVTGVNVLIDDTPEAVLLSCFDPVRREMGRITLTALVSDGRIHPHRIEEE
YARAEREVAAKCVRAGEDALIDVGIAEMHPELINLLGRLRYRTSYGQNVLAHLVESAHLA
GIMAAELRLPPAIAKRGTLLHDLGKALTHEVEGSHAIVGAEIARRYGEHEDVVHAIEAHH
NEVEPRSIGAVLTQAADQISGGRPGARRDSLESYVKRLERIEQIAAERPGVEKVFAMQAG
REVRVMVVPELVDDVAAHLLARDVAKQIEDELTYPGQIRVTVVRETRAVGMAR
Download sequence
Identical sequences A8L6J3
gi|158313073|ref|YP_001505581.1| WP_020458850.1.9268 298653.Franean1_1221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]