SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_6885 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_6885
Domain Number 1 Region: 13-85
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.61e-17
Family FHA domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_6885
Sequence length 202
Comment (Frankia EAN1pec)
Sequence
MDLSTIRVTTATGTVELTPDRSYVIGRSREADITVQDTKVSRRHVELAPGPDGWTARDLS
TNGVWSEGARAKQFAVDGEIRIRLGGLSGPEVLLRAFRPVQRPPAAAPRPKLDNADAETM
LAGQGRRPVPGQAAPPVPAARTPEPAGAGAGSAGASAGAGGGAGAGGGAAPRPALGGWLR
ALPTLVWLAAVGFALGALVALS
Download sequence
Identical sequences A8L2C8
298653.Franean1_6885 WP_020464285.1.9268 gi|158318617|ref|YP_001511125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]