SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_7060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_7060
Domain Number 1 Region: 90-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.65e-16
Family Laminin G-like module 0.069
Further Details:      
 
Weak hits

Sequence:  298653.Franean1_7060
Domain Number - Region: 480-554
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00104
Family STM3548-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_7060
Sequence length 757
Comment (Frankia EAN1pec)
Sequence
MSAEGCSVTSPVWVLGYSDEIIVRPGQDLTFRVGGQGVDTFHAHLVRLRHGDTTPGGPGF
RETELDSEVNGVYPLLDQPAHVGSFGRIPGARDILRSPDGSLTLFAFVQPTADGARQPVL
SGWDDATSTGVALVLTDGLRPALVFGAGQDSACLTAPTGLQAGTWYALAASWDGATGQAS
VTAVPVVNAYNSRFGRVVANPMVEITGALAGPPEIPAVDLLLGALDTTDGTVVRGAYNGK
IALPAVYRRPLTGDEVRQLAGSGKAPAVIEGLGAWWDLSTGIEGTEIAPGDRGEGERVAG
SLVNMPTRAVTAHNWDGSSYNWTAHPELYGAVHFHTDDVDDTGWAPTCTLSVGADLPSGV
YALRLRAGGFEDHVPFLVGAAQGEEKSIALLLPTASYQAYANEHLGSGSPIGQAVGGHTP
LVQPLDVLKLEHGEFGRSTYDLHVDGSGVAYTSRRRPILNMRPRYRFTHLGTWQFPADLY
LVDWLTEKGYEFDVLCDEDVHRRGVDAMRPYRVVMTGTHPEYTSERMLDSFEDYVVDGGR
VMYMGGNGFYWVVSFHPEKPWVMEVRKGEAGSRAWQAAPGETLHSTTGEKGGLWRNRGRA
PQKVFGTGFTAEGFNGSSYYRRMPDSAEAAVSWVFSGVGEEELIGDFGLEGAGAAGQELD
RADVRLGTPPGTYLLASSEYHDDSYLLVVEEIGFMYPGLGGSEHRDVRADMTLFETESGG
AVFSTSSIAWAGSLSHNDYDNNVARITANVLDRFSTL
Download sequence
Identical sequences A8L4Z1
298653.Franean1_7060 gi|158318788|ref|YP_001511296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]