SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI184365 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI184365
Domain Number 1 Region: 85-104,131-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-20
Family Glycosyl hydrolases family 16 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI184365
Sequence length 304
Comment (Laccaria bicolor)
Sequence
MGNLGRAGFGATLEGLWPYSYDSCDVGTLPNQTYPGGTTPLAAIQNGDPTFDGQLSLLSG
QRLSACTCKGESHPGPVRADGTYVGRASPEIDVFEAIVEDNVGMVSLSAQWAPYNAQYEW
KNTTANLRITDPGTVLNPYVGGAVQQTTSGLAHANPNCYELKKGCFSVYGFEYAPGFDNG
YITWINDAKVSWTIMSAGLAGDTRTEIGPRPVSQEPMYIIANLGISKNFGFIDLENLQFP
ATMSIDYIRVYQPANAINVGCDPANFPTAKYIETYAEAYSNFNLTTWTGDFKQPWPKNSR
AGDC
Download sequence
Identical sequences B0D741
XP_001879681.1.58555 29883.JGI184365 jgi|Lacbi1|184365|estExt_GeneWisePlus_human.C_90169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]