SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI191735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI191735
Domain Number 1 Region: 91-160,192-318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-28
Family Glycosyl hydrolases family 16 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI191735
Sequence length 337
Comment (Laccaria bicolor)
Sequence
MRLFASTALFALSPLPLVLGATYLLTDNIVGKTFYSNFDWEAIPDPTHGRVNYVNSATSS
SQNLTFATSDTFILRTDFKTVLDPNGPGRNSVRIRSKKTYTTHVAVFNMRHMPQGCGTWP
AVWETDGANWPNGGEIDILEGVNDQAPDLVSVHTSPGCTMPSSRTMTGTPTYLDCQTGAN
SNAGCGVKLSTTLSYGPAFNKVGGGWYVIERSPTYMKVWFWSRRDTSVPAEVANGGQYVN
PDTWGTPAAYFPNTSCDFPSHFDAHSIIINLTLCGDWAGATYGQTSCPSTCVGYVNNNPS
AFTDAYFDFASLRVYGATVPLTKRGVDVHGRAHRREF
Download sequence
Identical sequences B0DSY1
29883.JGI191735 jgi|Lacbi1|191735|estExt_GeneWisePlus_worm.C_410025 XP_001887071.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]