SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI236913 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI236913
Domain Number 1 Region: 37-141
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-17
Family Galectin (animal S-lectin) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI236913
Sequence length 165
Comment (Laccaria bicolor)
Sequence
MSYHLPVHQTVALKKEFKVENIIVFRSTKLDLTPSFGPGIDNTSVNIMSAADDYLLHINI
SFRRAQKAIVFNSKRANRSWGPEERVTLEGLFLNGLHTTITVYDHGDRFQVLIDYKTIHY
YVKRFHKNGAAVLYKYNTNFSVFSETLDVTMYDSFANIRVIPSCA
Download sequence
Identical sequences B0DI25
XP_001883510.1.58555 jgi|Lacbi1|236913|e_gwh1.21.77.1 29883.JGI236913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]