SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI250640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI250640
Domain Number 1 Region: 34-160,192-231,259-296
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-28
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI250640
Sequence length 317
Comment (Laccaria bicolor)
Sequence
MFKKSLLPVIVILPSLTSVFCATYTLSDEIVGTGFYNSFDWQNISDPTHGRVNYVDKTVS
QSLNLTFASSNTFILRGDSKTVLSANGAGRNSVRIQSKKTYRTHVAVFDVRHMPEGCGTW
PAVWEVAGSGWPNTGEVDIVEGVNNQGPNAVSLHTSAGCTMPASRQQTGTSTQLDCNTNI
NGGTGCGVLLSSQKSFGPTFNQNGGGWYAVERSATAIKVWFWARTECSVPNDVQTGNLAV
DPSNWGVPSAYFPNTTCDLAARFSDHYIIINLTFCGDWAGGAYAQSGCPSTCVDYVNKNP
SSFVNAHFDFASLRVYQ
Download sequence
Identical sequences B0DDT4
jgi|Lacbi1|250640|e_gww1.15.36.1 29883.JGI250640 XP_001882200.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]