SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI291488 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI291488
Domain Number 1 Region: 65-192,230-317
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-26
Family Glycosyl hydrolases family 16 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI291488
Sequence length 384
Comment (Laccaria bicolor)
Sequence
MLPAYFLIFIIYYPAVAIPQASSWFPSLSEHLWPSRSLYVASGNSINYNPNGSSFLWLPQ
DSYSGQTFFDLWDFFTGADPTNGQVNYVNETVARQTGLVYVQDNGIVIMKADNTTSLASG
VYRNSVRISSQAQYNTGLFILDLNRAPWGCAVWPAFWTVGGNWPYDGEVDIIEGVHDNEH
NQVAWHTAPGCTLDTTANFTGTISSSDGVNHTDCNAFINSNSGCGMTEWSRASYGPYFDS
QGGGVFAMKWDENSIAIWSFYRVAIPKDVIAGTPNPSGWGAPSAVLEPSDCNLGQLFANH
SIVFDITLCGDWAGNSYATSGCPGTCEQRLMDPANFQNASWSINSLKVYRKVLLSARVTN
SVTSKLTMEFTTLYLMILLGGLLL
Download sequence
Identical sequences B0CQ22
29883.JGI291488 jgi|Lacbi1|291488|estExt_fgenesh2_pg.C_10088 XP_001873806.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]