SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI291920 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI291920
Domain Number - Region: 27-122
Classification Level Classification E-value
Superfamily POZ domain 0.000691
Family Tetramerization domain of potassium channels 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI291920
Sequence length 266
Comment (Laccaria bicolor)
Sequence
MSSLQNGTVVGEPSDAESRTSEYFCDAAADVVFQSSDGVLFRVYRTHLESHTGGFAPAEI
PTLDEVVVLSEPAEVLELLFQFTQPSRQPDVLNLEFDLLFALAEAAEKYEAYGAMSLCNM
RMHYIVEQKPMEILNYALKHGYAELANKAAPITVSARPALTLAAENLTFPGALATWIKYY
AQWDRLARDSLDFLVTYQHHDHYPSGSNIWTLITTQHILIRILTSDKFAARKLLKERGHS
AWITSITRNDWRQPIQLSKLADAMKA
Download sequence
Identical sequences B0CPV5
29883.JGI291920 jgi|Lacbi1|291920|estExt_fgenesh2_pg.C_10892 XP_001874336.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]