SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI297995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI297995
Domain Number - Region: 243-287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0811
Family Laminin G-like module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI297995
Sequence length 331
Comment (Laccaria bicolor)
Sequence
MDDELRLDGKNRCHGASSRSILRRDPISVTVTIRTMPPPPLSPLIPIPDFLTGFTTCTSL
NDKRIQIVALDDQSLGVHRLSHKTTHKTTIPPSPHSPSPDIPPPDVAWGAYYPKGSINPT
APIPGGFSFYLYGPPFFSEALQGAKEVVMSYRMMLSEEWDWVKGGKLPGVFGGVGDLAYG
CTGGRKEQRCQCFDLRVMWRPKSVGELYAYLPPTPCNAHQLSRVPPLSKENSDYGYSVGR
GAFHLDRAVGRWMSVAFRVKLNDVGEENGEVTLYIDGAPVISIDGLSLCSSGEGKFTGMH
FQTFFGGHADDWASSKDQRAWFADVTGVIVE
Download sequence
Identical sequences B0DC04
jgi|Lacbi1|297995|eu2.Lbscf0013g00690 29883.JGI297995 XP_001881436.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]