SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI300987 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI300987
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.31e-38
Family Nip7p homolog, N-terminal domain 0.0000202
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 3.91e-25
Family PUA domain 0.0000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI300987
Sequence length 180
Comment (Laccaria bicolor)
Sequence
MRPLTEDESKAIFTKLANYIGKNLVHLIDRPDEPYCFRLQKDRVYYVSESSMRLGISVAR
PNLVSLGTCFGKFSKSGKFKLHITALDYIAQYAKYKVWIKPNGEMPFLYGNHVVKAHLGR
ITEDTPEHQGVVIFSMNDIPLGFGVTARSTTDTRKLDPTSIIVFHQADVGEYLRDEDTLF
Download sequence
Identical sequences B0CR22
29883.JGI300987 jgi|Lacbi1|300987|eu2.Lbscf0001g04360 XP_001873334.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]