SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI301862 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI301862
Domain Number 1 Region: 13-100
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI301862
Sequence length 106
Comment (Laccaria bicolor)
Sequence
MSRQDKVTTERFTRTLREMVKRPENKLCADCKRNDPRWASWNLGVFLCIRCSGIHRGMGT
HISKVKSVDLDVWTPEQMESIQKWGNHRANLYWEAHLKSGHTPPEQ
Download sequence
Identical sequences B0CPK5
29883.JGI301862 29883.JGI314436 XP_001873681.1.58555 XP_001889058.1.58555 jgi|Lacbi1|301862|eu2.Lbscf0001g13110 jgi|Lacbi1|314436|eu2.Lbscf0061g00170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]