SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI302731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI302731
Domain Number 1 Region: 400-519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000943
Family Tandem AAA-ATPase domain 0.035
Further Details:      
 
Weak hits

Sequence:  29883.JGI302731
Domain Number - Region: 66-125
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0573
Family Xylanase/endoglucanase 11/12 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI302731
Sequence length 541
Comment (Laccaria bicolor)
Sequence
MIGGSTDRQNTARRLMTKMVNTLTAKMEIGSPMASLYLLGNPDHYTSHKFILFYWKNYVR
EARSAWIDTENNTTESFNTEYKDAPDKVVLQKYDGTYIGISSVYDYIYRPTAYERMSLYG
WICKAKKEKRSKEEQQEFDVHYDKDELESNAEDDGTDTEGEDEINFLGGGDSIDDDIEDE
VGHQDLDSEDELNDYQIMYDEHESHEFLPEHPQYCGLPRCDQGDREYYCSTMLALFKPWQ
CGKYLKLENESWDEAFVGYSFSARQLELMKNFNIKYKCNDAQDDYSAEMKKKDARENIFG
SWEDIGGEVDTNCSLINEDIPIDIDEDMYMLGNPNSINNQKLHEMNRIENVVKNAGWLDS
CIGNIDPVDTSFKPGEKQSGSQWNVLVQSLKKLFIATRSKNLPEAKAIKDKNSTSNDEVV
VDDISYLNKIFKAEKEHEHQLINTIVHEFSLNDEQERAFRIVANHATMTKSEQLKMYLGG
MGGTGKSQVIKALIAFFDRRNESHRIMILAPTGSAAALLNGSTCGCGPVLCMACMSPFCG
L
Download sequence
Identical sequences B0DI61
XP_001883625.1.58555 jgi|Lacbi1|302731|eu2.Lbscf0022g00210 29883.JGI302731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]