SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI303665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI303665
Domain Number 1 Region: 147-260
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000493
Family Glycosyl hydrolases family 16 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI303665
Sequence length 271
Comment (Laccaria bicolor)
Sequence
MHFLLSAWAFAQSLFDLTALTGISNYDSSMSLTSTRHAHGLRQSRARAAASDVAMRAFKA
EALASNASFLQRLDPDGCLHVSHNFLNYQTYPGYDNSIGISGPGPNGYRMFSSTSDINDP
NTESRLRYDFVFNDGSAPYTSIWITMRGAPDSGKNSNVVLREELCVVGPLDPNGSHYHDC
DEIDIAEIYGGGNNQAEFTFYTGSGSYIPGKQPQRQGGGVYTDTTNGGAGQQFYEYQLYL
EQGKYLTFTIADVKIGQTIGKRDYGPPGIPA
Download sequence
Identical sequences 29883.JGI303665 jgi|Lacbi1|303665|eu2.Lbscf0259g00020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]