SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI305507 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI305507
Domain Number 1 Region: 90-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.39e-23
Family Glycosyl hydrolases family 16 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI305507
Sequence length 313
Comment (Laccaria bicolor)
Sequence
MSSGLFVVLLFTQLLLFSLAARPHHRASQCQPLKTSFSDASSVAANLSASFVAVSPEESY
QVGKSGLELLLKGPDGNVISEGGVNDELGTGATVNSTFFLLYGVVTFEIAAPPVPGIVTA
AILLSNATDEIDIEILGADVTHWQTNMFAPPSGTNNSTPAQPMYNVFSSVEGIGANHTDI
TKTHSYFINWTSTQIDWGVDGQVVRTLKKGVDYLNCSARRLKYASSGHRKEWSILFPFSS
CSDSDRNLGCKQPIRNVSMGERSSQLGTSSRDNECHGEEHHSRMSMRGVKRYLQCKSVLL
MVLRALFDFELVL
Download sequence
Identical sequences B0CUE8
jgi|Lacbi1|305507|eu2.Lbscf0002g05650 XP_001875217.1.58555 29883.JGI305507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]