SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI311083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI311083
Domain Number 1 Region: 30-159,190-230,258-321
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-20
Family Glycosyl hydrolases family 16 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI311083
Sequence length 395
Comment (Laccaria bicolor)
Sequence
MKMYRQWPLLLFTLLPACWAYDIVQDYSGSSFFDKWDFYGNWDNLTLGDVWWLGRQDAFA
QGLVYVNNAGNAILKVDDVSNVALNQKRNTVRITSQAAYNVGSLWIADIVHLPFGCSVWP
AFWTKGTLLWPDGGEIDIIEGINLVSQNQMALHTLPGCYHNTTPPNQMGISDPTKVDCSQ
PSGCVVSESAPNSFGQGFANAGGGVFGVQFDVAGVFIWFWSRPSIPASIANANATSSINV
SDWGAPSASYPASEPCNITQFFTPQNLVIDITLCGIWAGLPAQYLPQCSGAGPTGICYND
NVVGPGGRYSNAYFEIKYVRAYTTGGIAPTPTAAAHALLSQAVTSTIKTTSPAGTVLVPS
PLFFPGNTARRGFEVQGWRLTLVGIIVVMTTYLVW
Download sequence
Identical sequences B0CZ70
XP_001876832.1.58555 jgi|Lacbi1|311083|eu2.Lbscf0004g00390 29883.JGI311083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]