SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI312069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI312069
Domain Number 1 Region: 52-145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000138
Family Galectin (animal S-lectin) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI312069
Sequence length 157
Comment (Laccaria bicolor)
Sequence
MSQSLDSCQRILSKSNGLLPPSHQTVTLKTPFKAENIIVFQSAKLDLTPSTGPGIDNTAV
NILDAAGDVLLHVSIRRAENAIVLNSRPANGARGTEERVPLKGLFVNAPNTTITVYDHGD
RFQILIDYKTVHYYAKRIQANGTAILYTINPGQISVL
Download sequence
Identical sequences B0CZ07
29883.JGI312069 jgi|Lacbi1|312069|eu2.Lbscf0004g10250 XP_001877242.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]