SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI315268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI315268
Domain Number 1 Region: 54-82
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000484
Family G proteins 0.047
Further Details:      
 
Weak hits

Sequence:  29883.JGI315268
Domain Number - Region: 89-124
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 0.000366
Family Transducin (alpha subunit), insertion domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI315268
Sequence length 237
Comment (Laccaria bicolor)
Sequence
MFVQTTDDPLDEVLKPPPDESPEHRAIRLQNEAEAKSVSLAIDAGIKAELHARRKKRIVR
LLLLGQSESGKSTTLRQFQRLYTPTAFREERILWRAVIQLNIVRSIRTILNALTFPSTSW
HTSPYSSPRSRAHTIFLPPLPNHPPLPSIEYELYNGNGNDTTLTFGSSSPTSVNRHPHHH
SHSPPSNPDSDADSESDFVYPHQHGHYPHRSPPSNPSITLAPTPGLDARKRACAPXX
Download sequence
Identical sequences 29883.JGI315268 jgi|Lacbi1|315268|eu2.Lbscf0069g00500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]