SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI324053 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI324053
Domain Number 1 Region: 158-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.91e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 2 Region: 72-139
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000112
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 
Weak hits

Sequence:  29883.JGI324053
Domain Number - Region: 246-302
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0942
Family Outer membrane efflux proteins (OEP) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI324053
Sequence length 350
Comment (Laccaria bicolor)
Sequence
MSSKWDQPAPAAASSTTEEQLLSTSASIVNGKTAAEAAAAAAAIAAKIAAQFADGTLGGL
NEAYSKDIDINDVRNRYMLTRGSTQTEIHEETGASVSTKGVWYPDRTKATEKDPPLYLHV
TAATPEILQKALDKIDELMSIDLGSLVEDKKSLMKRKWPEEKLPVGLETIRNFNVRAKVV
GPQGSFVKYIQQETGTRVQIKGIGSGFIDQETGREGDEPLYIHISGPEDGQVARAKVLTE
DLLLVVRSEHAKAQAIIHQQQMELHQAQAQYAAYSAMAGYAPPPGSAPPPPPPGEQPPPP
PGEMPPQPAGGPPPPGTDQASHDAFATYWAAYGYDVNSSQFKEWAAQQQQ
Download sequence
Identical sequences 29883.JGI324053 jgi|Lacbi1|324053|fgenesh3_pg.C_scaffold_5000160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]