SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI328376 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI328376
Domain Number 1 Region: 42-107
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000301
Family Glycosyl hydrolases family 16 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI328376
Sequence length 114
Comment (Laccaria bicolor)
Sequence
MSSTDFFLLSCMDSGENSNVVLHEEFCVVGPLDPSSSHYHDCDEIDIAEIYGDGNKQAEF
TFYTGSGSYIPGQQPKHQGGGVYTDTTNGAAGQEFYEYQVYLERGRISRSLLRM
Download sequence
Identical sequences B0DEP2
jgi|Lacbi1|328376|fgenesh3_pg.C_scaffold_16000141 29883.JGI328376 XP_001882436.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]