SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI332008 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI332008
Domain Number 1 Region: 623-766
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-20
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 2 Region: 411-486
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000239
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 
Domain Number 3 Region: 868-971
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000506
Family Calponin-homology domain, CH-domain 0.0067
Further Details:      
 
Weak hits

Sequence:  29883.JGI332008
Domain Number - Region: 60-127
Classification Level Classification E-value
Superfamily SH3-domain 0.000133
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI332008
Sequence length 1267
Comment (Laccaria bicolor)
Sequence
MSSGQSARIIIAATSDFCARSEALQMNPMTAAILAAQFSQGSSCLGLGVYCDVWLTKYRS
PSSVQVQGVMPEYVSALYDCLSKPKDQCSFRTGERTAVVEQGNMSINGLWKSHNRTGAVA
FSPKSYTSLAAPSIKSPPAVRSITFAVESSRDLDGEPEFTLPRLKQLTAPFPNPGDHNNE
DLEGPESSGEGDRVLNASVGDGQMIERFERDADGDVVSFLDVDTETDEGGSEMSDTRHAS
DVNVSHDWHKSARTKLAEKTWRATQKLEALPKPYPRGEVEGGQAVRHVVFPNKHESEQTV
TTGSPPVFQLAPLSNLLFREATFVEEKIPSPASTSATVPQARIFAWEEQKGTTTAALQLP
FSGLPSSTPTVPIGVSPLKRNDTVSSSPTNPTPAYHQLVSEDKTEGGENEKDPTEWTVKE
VVEWLKGKGIDQNIRDKFVEHEITGDVLLTLDVDLLKMEVGVMGFGKLMCIANAITDLRW
PPSRVYSDHPKDPSLFPSGEAPKKKVILPPNRVEDVNRTWGEAVPLQSTRRQPFGLSHDS
TSPTGDSSKPSQGTFTPASSPPSDGDKFGAGDKPTFFALPFGKRRKPPPTVGEDVEIQPE
RLLFSLSKGGNPSSTHLQRPSTHSNPSFKNPQTSSDGPRSPERVGGTLMDGKSSIAVQQG
QTILTQIGEPDHIGWMHKKRDGGNSWKPHYFVLKGQRLFWLKSDSNMNTHLEGFIDIVGY
KVTMDETLYPGRYGFRIDRDQDKTHFFTSDSVSIIREWVKAIMKATIARDHTKPIISPCT
IPTIPLAVAQAMVPAPRPPSPATLRALQRENHNRLSHRGDNIHSVIFPDIRSDQTHLATA
GTPSSLPQNSAFLKPKEKRSASSSHSALNPTDSRLVEWANFHLPPSLQVDDPTTSFFGGL
ALLRLAESIGGTCFPPVPDSAFPVDPTDNDLDGLFRLFDLLLDNGVHTGSVCINDIRQGK
RGKILQLLKALKSWEDRRGVLAATMNGTLHPGGGGAFSVPTGMWAESRIFNSAIPNIAYS
TRLRFATEHIMTKSSKPTLSHLGESPQLANQSKRHSRFLMKAILPLDIFEEVLRNLATSE
DTVTLNHASPVPNTRRIVASVLIFENWAFGVAERKYWGGLLENTENFHSIPQLEELHLGL
NGQPFLDSICRAHNDGTSPLNLSRLRSLYLSSRKDPPDMIPNIEPILKSWNPRVEVLTVS
CGFDLLEPFRTVLKRWASAGGSGLREIKIEVLSMGFRVAGSRFFHHRVFAGDTVEQLQGT
PPRIASC
Download sequence
Identical sequences B0DR96
XP_001886455.1.58555 jgi|Lacbi1|332008|fgenesh3_pg.C_scaffold_38000015 29883.JGI332008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]