SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI332912 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI332912
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-20
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 2 Region: 841-941
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-19
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 3 Region: 397-461
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000033
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 
Domain Number 4 Region: 1060-1162
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000131
Family Calponin-homology domain, CH-domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI332912
Sequence length 1481
Comment (Laccaria bicolor)
Sequence
MPDYVYALHDFLPENEDEVSFRAGDRIEVIEKDDMYGDGWWQGRNLKGKVGLFPKSYTAP
AAPSTEVPAPQSTPSASAETSSAPTGEPEITTIASPQPKKLTPTFLSGHHDDEGYVEVPD
NGDLRGNGDELRMTDVQRTIEQLARGGADGEGGFTFASSHGGDTETDETDFEMSDTERAN
DVNGAQDWHKGARTKLAEKARRAVEEAEAIMTGIIGSSSGTGRMVSAPPIEAEWSDEGDD
EGGPFDRMDFTSRSSKVQREKPYILEEVEEVENGEASKGGHAQDLSMDAATTITHLSSDS
GDHLQEKDELEAQTATKTSFPVFQSPPPSNLPPLLDEKIPSPARLPSAKPSSIPTDPTAA
SLSKHNSVMSSFSSNAPSVALAPAYQPVVEEKEVGKKYPSEWTVEEVVEWLKNKEFDQAI
CDKFIGDVLLELDVNLLKTEIGVMAFGKRTRIANAITDLRLGPPSIVYSDHPMTEMPSRS
SPMYNASDAPPRVHSSQSHTHHSSSGTSGHDSSQSVQSSLGSPIAYGAGMLPQFSFGGPG
HFGPAVAEGGSSSGDIYSHWNGLEIPPVVDEGVPTALTFEDVQGKSTFLLDANGGLKKGR
PSQLTLSPSDGALKEKIILQPEQNEDEDRGHMGEGEVEVPPQSMRRRRLNSRSHDSTTSG
GHSSPKHSIGISSPGAPTHSHEDKNTTSLTNGSVKQARVRKDTDGGKPGNTLSLFAVPFA
GKSRKPPPSAGEHEYHAEKSSMFGLPKGMCKSSSTHSQRPSTPTGSPKEKLKEPQSSFKD
RHEKGRKEEERNEKVAADIERSTLRKRGVSSVQQSNGSSVDGKSLIGVGGGVTQGQSILG
QIGESDHVGWMRKKSDRHNSWKLRYFVLKGRHLYWLKSSSVSETRLKGYLDIMGYKVTVD
ETLDPGRYGFRIDHDADKPHFFSSDEKSIIREWMKAIIKATIGRDYAKPVISSCKIPTIP
LVVAQAMNPAPRPPSPTARDATQRALRRENPNQLSSRDARVLMGLSSHMGSGQTHLNSFF
AEHTAIENDETVPKSPKSAPSIPSRGMRRANSVRSALSPADNALVEWANSHLSASLQVED
PTVSFFGGLALLRLAEYIKGRPSSPPVPDSAFPVGPTDDKLDGLFLLFDFLLDNDVTMGS
VSINDIRQGKRDKILQLLKALKSWDDKRRALAQTMNGTLNPSGGGAFLMPTGMQWAMCLM
SVLTFAPSLSFLPQSIRPMNSIEFRPSEYEFKRPQPMVQLSRDLIPSFEAEAHHQKYVQR
WSTLDLWRRLCRVLLIRESSPCHPNSLAIQHAIVVHFPSSQQLCSSPVPSIRKPIPPSTL
TSSSSLRSLREPLIRELPLHTIWMEWRLLRSDSSFIKGFLWQTAKIEDNCVLRDRTYMRG
IFWRWRLNLTEREVAGTCGPRIHLEVTSLANGWGNLHGLHEDARFENFWLMPTSRPGVRG
ARIVCCLYQCVLKWFVLLRSAEAALRCHHHASIWHLFQKEI
Download sequence
Identical sequences B0DU89
jgi|Lacbi1|332912|fgenesh3_pg.C_scaffold_45000075 XP_001887516.1.58555 29883.JGI332912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]