SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 300267.SDY_2624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300267.SDY_2624
Domain Number 1 Region: 6-249
Classification Level Classification E-value
Superfamily SIS domain 3.11e-65
Family mono-SIS domain 0.000000284
Further Details:      
 
Weak hits

Sequence:  300267.SDY_2624
Domain Number - Region: 235-280
Classification Level Classification E-value
Superfamily UBA-like 0.0357
Family UBA domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 300267.SDY_2624
Sequence length 298
Comment (Shigella dysenteriae)
Sequence
MQLEKMITEGSNAASAEIDRVSTLEMCRIINDEDKTVPLAVERVLPDIAAAIDVIHAQVS
GGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQHAVEGAEDSREGG
INDLKNIGLTAQDVVVGIAASGRTPYVIAGLEYARQLGCRTVGISCNPGSAVSTTAEFAI
TPVVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGKVFGNLMVDVVATNEKLHVRQVN
IVKNATGCNAEQAEAALIACERNCKTAIVMVLKNLDAAEAKKRLDQHGGFIRQVLDKE
Download sequence
Identical sequences A0A090NWG1 E2X6L4 Q32DC6
gi|82777821|ref|YP_404170.1| gi|560158247|ref|YP_008850962.1| 300267.SDY_2624 WP_001175604.1.35349 WP_001175604.1.50304 YP_404170.1.10455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]