SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 300267.SDY_3343 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300267.SDY_3343
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-50
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 324-515
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.86e-46
Family Ribonuclease PH domain 1-like 0.0000184
Further Details:      
 
Domain Number 3 Region: 168-258
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-31
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 473-571
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 249-348
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.2e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 577-662
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.45e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 7 Region: 643-720
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.5e-22
Family Cold shock DNA-binding domain-like 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 300267.SDY_3343
Sequence length 734
Comment (Shigella dysenteriae)
Sequence
MRRRSGINTSAVRYCLRKRKDITLLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDD
TAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDR
PIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYI
NDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQ
NINELVKEAGKPRWDWQPEPVNEALNARVAALAEARLSDAYRITDKQERYAQVDVIKSET
IATLLAEDETLDENELGEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRT
HGSALFTRGETQALVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGIVGSPK
RREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPI
KAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKE
IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIR
ALTEETGTTIEIEDDGTVKIAATDGEKAKHAIRRIEEITAEIEVGRVYTGKVTRIVDFGA
FVAIGGGKEGLVHISQIADKRVEKVTDYLLMGQEVPVKVLEVDRQGRIRLSIKEATEQSQ
PAAAPEAPAAEQGE
Download sequence
Identical sequences YP_404827.1.10455 gi|82778478|ref|YP_404827.1| 300267.SDY_3343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]