SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 300267.SDY_3488 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300267.SDY_3488
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 5.89e-22
Family Ribosomal protein L29 (L29p) 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 300267.SDY_3488
Sequence length 63
Comment (Shigella dysenteriae)
Sequence
MKAKELREKSVEELNTELLNLLREQFNLRMQVASGQLQQSHLLKQVRRDVARVKTLLNEK
AGA
Download sequence
Identical sequences A0A090NXZ7 E2X8A6 Q32B39
gi|82778608|ref|YP_404957.1| 300267.SDY_3488 WP_000644743.1.1867 WP_000644743.1.18874 WP_000644743.1.35349 WP_000644743.1.50304 WP_000644743.1.82626 WP_000644743.1.94880 YP_404957.1.10455 gi|560159326|ref|YP_008852041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]