SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 300268.SBO_2355 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300268.SBO_2355
Domain Number 1 Region: 8-265
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.04e-94
Family Pseudouridine synthase I TruA 0.000000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 300268.SBO_2355
Sequence length 270
Comment (Shigella boydii Sb227)
Sequence
MSDQQQLPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTD
AGVHGTGQVVHFETTAPRKDAAWTLGVNANLPDDIAVRWVKAVPDDFHARFSATARRYRY
IIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMH
INVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATA
KAEGLYLVAVDYPDRYDLPKPPMGPLFLAD
Download sequence
Identical sequences I6DYB1 Q31YE0
300268.SBO_2355 gi|82544799|ref|YP_408746.1| WP_001283574.1.13144 WP_001283574.1.14253 WP_001283574.1.15768 WP_001283574.1.16862 WP_001283574.1.17734 WP_001283574.1.19651 WP_001283574.1.21024 WP_001283574.1.2325 WP_001283574.1.26125 WP_001283574.1.27426 WP_001283574.1.35039 WP_001283574.1.44452 WP_001283574.1.52704 WP_001283574.1.55185 WP_001283574.1.55870 WP_001283574.1.57349 WP_001283574.1.86717 WP_001283574.1.88557 WP_001283574.1.93150 WP_001283574.1.97502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]