SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_0082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_0082
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily LigT-like 1.62e-39
Family 2'-5' RNA ligase LigT 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_0082
Sequence length 181
Comment (Methanocella paludicola SANAE)
Sequence
MIRAFISVNLTPGIRQKIGEAERDFDMKGIKLVEPSLIHVTLKFLGNIEEAKVGEIEAAL
KKVSVRPFKARMRSLGGFPNPRNPRVIWVGAEGDFAELNKQVEALMEEIGFPREGRFQPH
VTIGRVKFPTPEQKQDLPGLFEKYKDFDAGEMTVDSIHLMKSTLSPKGPRYDVLKEIPLA
R
Download sequence
Identical sequences D1YUN2
gi|282162752|ref|YP_003355137.1| 304371.MCP_0082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]