SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_0772 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_0772
Domain Number 1 Region: 1219-1427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.57e-37
Family Clostridium neurotoxins, the second last domain 0.047
Further Details:      
 
Domain Number 2 Region: 335-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-36
Family Clostridium neurotoxins, the second last domain 0.039
Further Details:      
 
Domain Number 3 Region: 1487-1695
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-36
Family Clostridium neurotoxins, the second last domain 0.041
Further Details:      
 
Domain Number 4 Region: 57-204,232-306
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.25e-24
Family NodB-like polysaccharide deacetylase 0.013
Further Details:      
 
Domain Number 5 Region: 805-1031
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.31e-23
Family NodB-like polysaccharide deacetylase 0.0084
Further Details:      
 
Domain Number 6 Region: 596-799
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-19
Family Pentraxin (pentaxin) 0.08
Further Details:      
 
Domain Number 7 Region: 1035-1143
Classification Level Classification E-value
Superfamily CalX-like 6.28e-16
Family CalX-beta domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_0772
Sequence length 1701
Comment (Methanocella paludicola SANAE)
Sequence
MRWDSRTNIRLVIGVLNIDELGERFCSNINQREKIIKILTVLAIAIFIGQIFSLPTLADS
SPSITPTPTITSALTPSPSNNAGIAITFDDSSVDAWYGIRDLLNRYNAKATFFVTEFDQL
SDSQINELKALQSDGNEIACHGYRHVSVTDYLNAGHTMDDYIRTEIQPAIAAMQAKGFTP
IDFAYPFGDRNSVSDAALLNVFTHLRGTTYTGGGITVPTLDQAYFKFNGERVVWGVGMDN
NFGNPLNDFQKGLDRAKANDQVLVTYSHIPGTSTTDDYVTPVSKLEAILKYASDNGMTFY
RISDLPGSTPTPTPTPTPTPTPTPTPTPTPSPGPGIVKDGLELWYDMNDTGSTLTDLSGN
GNVGVVNGATYVMLPSGAGSRSFNGATSYIQCHDSPGLNPTSGMTIEVLFSPRNFMSTQS
LASKGYSTNTGQGYNMRLNSDKTLDFFMYDGNQNMAYIKCNPGLTADKWYMATAVYDGST
ISLYVNGVKYTSSTCNGASPSSVDLTIGRYSPSAAWPYNGSIATVRAYNRGLTSQEVASN
YNADAWRTAISPSPTPTPTPTTTPTPTPTPTTTPTPTPTPTPTPTVTPTPDIAHEKLYYM
FVNDSGNTIVDSYNIHNGTNHGTTVSTIPYPTGGAQRYFNGSTYIDSNMVTTSNSFTLRV
WMNDSNLSLGYKQMVAGSWYDGGSYGGEKGFGIFTYSSQVYAVMGNADKEGVYLKTDLPS
NMWFDVAITYNASTKEFIMYINGVRFKNITTNGYTPYFSNLTIGTYSPGSYQYVGYMGSV
LIDDTAYTPEAILADYNATKSQYNLAPGHTEEGGVAFTFDDAYVEDWYTIVAPLFAAHNA
NATFYLSRPQLVTEQQKTMLLELYTAGHEIGSHSAHHTNAVDYVTSYGEQAYLNYDISPA
MASIYAIGIPTPMDFAYPGGYNNAQTDALLLKDQFTSIRTSDTLLGGSYPIYYTWDNRRL
HYVYDVDNLADYSTIYPLMDWAKENHVVLMLLIHDISDIPGPYKTSVSNLTALVEYADNI
GLKFYRVNELVDPYFTVGITNTTYKAKEGDNVTINMKMSHAYGYPISVNVTSVDGTGHAI
TDYTPINEVITIPAGGTSANCVVHLKDDGENTGDKNFTIRLESGVNVTINPLMDEATITI
LESGNTTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP
TPTPTPSPTPTPTPSPGPGIVKDGLELWYDMNDTGSTLTDLSGNGNVGVVNGATYVMLPS
GAGSRSFNGATSYIQCHDSPGLNPTSGMTIEVLFSPRNFMSTQSLASKGYSTNTGQGYNM
RLNSDKTLDFFMYDGNQNMAYIKCNPGLTADKWYMATAVYDGSTISLYVNGVKYTSSTCN
GASPSSVDLTIGRYSPSAAWPFNGSIATVRAYNRGLTSQEVADNYNTDAWRTAISPSPTP
TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSPTPTPTPSPGPGIVKDGLELWYDMN
DTGSTLTDLSGNGNVGVVNGATYVMLPSGAGSRSFNGATSYIQCHDSPGLNPTSGMTIEV
LFSPRNFMSTQSLASKGYSTNTGQGYNMRLNSDKTLDFFMYDGNQNMAYIKCNPGLTADK
WYMATAVYDGSTISLYVNGVKYTSSTCNGASPSSVDLTIGRYSPSAAWPYNGSIATVRAY
NRGLTSQEVADNYNTDAWRII
Download sequence
Identical sequences D1YWM2
304371.MCP_0772 gi|282163442|ref|YP_003355827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]